![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
![]() | Superfamily b.70.3: Dipeptidyl peptidase IV/CD26, N-terminal domain [82171] (1 family) ![]() |
![]() | Family b.70.3.1: Dipeptidyl peptidase IV/CD26, N-terminal domain [82172] (1 protein) |
![]() | Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82174] (10 PDB entries) |
![]() | Domain d1u8ea1: 1u8e A:39-508 [107733] Other proteins in same PDB: d1u8ea2, d1u8eb2 |
PDB Entry: 1u8e (more details), 2.2 Å
SCOP Domain Sequences for d1u8ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8ea1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens)} srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq
Timeline for d1u8ea1: