Lineage for d1u83a_ (1u83 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 476895Superfamily c.1.27: (2r)-phospho-3-sulfolactate synthase ComA [102110] (1 family) (S)
  5. 476896Family c.1.27.1: (2r)-phospho-3-sulfolactate synthase ComA [102111] (1 protein)
  6. 476897Protein (2r)-phospho-3-sulfolactate synthase ComA [102112] (2 species)
  7. 476900Species Bacillus subtilis [TaxId:1423] [110387] (1 PDB entry)
  8. 476901Domain d1u83a_: 1u83 A: [107732]
    Structural genomics target

Details for d1u83a_

PDB Entry: 1u83 (more details), 2.2 Å

PDB Description: psl synthase from bacillus subtilis

SCOP Domain Sequences for d1u83a_:

Sequence, based on SEQRES records: (download)

>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis}
dfslelpvrtnkpretgqsilidngyplqffkdaiagasdyidfvkfgwgtslltkdlee
kistlkehditfffggtlfekyvsqkkvnefhryctyfgceyieisngtlpmtnkekaay
iadfsdeflvlsevgskdaelasrqsseewleyivedmeagaekvitearesgtggicss
sgdvrfqivddiissdidinrlifeapnktlqqgfiqkigpnvnlanipfhdaialetlr
lglrsdtff

Sequence, based on observed residues (ATOM records): (download)

>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis}
dfslelpvrtnkpretgqsilidngyplqffkdaiagasdyidfvkfgwgtslltkdlee
kistlkehditfffggtlfekyvsqkkvnefhryctyfgceyieisngtlpmtnkekaay
iadfsdeflvlsevgskdqsseewleyivedmeagaekviteqivddiissdidinrlif
eapnktlqqgfiqkigpnvnlanipfhdaialetlrlglrsdtff

SCOP Domain Coordinates for d1u83a_:

Click to download the PDB-style file with coordinates for d1u83a_.
(The format of our PDB-style files is described here.)

Timeline for d1u83a_: