Lineage for d1u83a_ (1u83 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090111Superfamily c.1.27: (2r)-phospho-3-sulfolactate synthase ComA [102110] (1 family) (S)
    automatically mapped to Pfam PF02679
  5. 2090112Family c.1.27.1: (2r)-phospho-3-sulfolactate synthase ComA [102111] (1 protein)
  6. 2090113Protein (2r)-phospho-3-sulfolactate synthase ComA [102112] (2 species)
  7. 2090114Species Bacillus subtilis [TaxId:1423] [110387] (1 PDB entry)
    Uniprot O06739
  8. 2090115Domain d1u83a_: 1u83 A: [107732]
    Structural genomics target
    complexed with gol, po4

Details for d1u83a_

PDB Entry: 1u83 (more details), 2.2 Å

PDB Description: psl synthase from bacillus subtilis
PDB Compounds: (A:) Phosphosulfolactate synthase

SCOPe Domain Sequences for d1u83a_:

Sequence, based on SEQRES records: (download)

>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]}
dfslelpvrtnkpretgqsilidngyplqffkdaiagasdyidfvkfgwgtslltkdlee
kistlkehditfffggtlfekyvsqkkvnefhryctyfgceyieisngtlpmtnkekaay
iadfsdeflvlsevgskdaelasrqsseewleyivedmeagaekvitearesgtggicss
sgdvrfqivddiissdidinrlifeapnktlqqgfiqkigpnvnlanipfhdaialetlr
lglrsdtff

Sequence, based on observed residues (ATOM records): (download)

>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]}
dfslelpvrtnkpretgqsilidngyplqffkdaiagasdyidfvkfgwgtslltkdlee
kistlkehditfffggtlfekyvsqkkvnefhryctyfgceyieisngtlpmtnkekaay
iadfsdeflvlsevgskdqsseewleyivedmeagaekviteqivddiissdidinrlif
eapnktlqqgfiqkigpnvnlanipfhdaialetlrlglrsdtff

SCOPe Domain Coordinates for d1u83a_:

Click to download the PDB-style file with coordinates for d1u83a_.
(The format of our PDB-style files is described here.)

Timeline for d1u83a_: