![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.27: (2r)-phospho-3-sulfolactate synthase ComA [102110] (1 family) ![]() automatically mapped to Pfam PF02679 |
![]() | Family c.1.27.1: (2r)-phospho-3-sulfolactate synthase ComA [102111] (1 protein) |
![]() | Protein (2r)-phospho-3-sulfolactate synthase ComA [102112] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [110387] (1 PDB entry) Uniprot O06739 |
![]() | Domain d1u83a_: 1u83 A: [107732] Structural genomics target complexed with gol, po4 |
PDB Entry: 1u83 (more details), 2.2 Å
SCOPe Domain Sequences for d1u83a_:
Sequence, based on SEQRES records: (download)
>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]} dfslelpvrtnkpretgqsilidngyplqffkdaiagasdyidfvkfgwgtslltkdlee kistlkehditfffggtlfekyvsqkkvnefhryctyfgceyieisngtlpmtnkekaay iadfsdeflvlsevgskdaelasrqsseewleyivedmeagaekvitearesgtggicss sgdvrfqivddiissdidinrlifeapnktlqqgfiqkigpnvnlanipfhdaialetlr lglrsdtff
>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]} dfslelpvrtnkpretgqsilidngyplqffkdaiagasdyidfvkfgwgtslltkdlee kistlkehditfffggtlfekyvsqkkvnefhryctyfgceyieisngtlpmtnkekaay iadfsdeflvlsevgskdqsseewleyivedmeagaekviteqivddiissdidinrlif eapnktlqqgfiqkigpnvnlanipfhdaialetlrlglrsdtff
Timeline for d1u83a_: