SCOPe 2.06: Domain d1u7vb_: 1u7v B:

Lineage for d1u7vb_ (1u7v B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.1: SMAD domain [49880] (5 proteins)

6. Protein Smad4 tumor suppressor C-terminal domain [49881] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49882] (6 PDB entries)
   Uniprot Q13485 314-546

8. Domain d1u7vb_: 1u7v B: [107730]
   Other proteins in same PDB: d1u7va_, d1u7vc_

Details for d1u7vb_

PDB Entry: 1u7v, 2.7 Å

PDB Description: Crystal Structure of the phosphorylated Smad2/Smad4 heterotrimeric complex

PDB Compounds: (B:) Mothers against decapentaplegic homolog 4

SCOPe Domain Sequences for d1u7vb_:

Sequence, based on SEQRES records:

>d1u7vb_ b.26.1.1 (B:) Smad4 tumor suppressor C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
isnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrt
eaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsa
yikvfdlrqchrqmqqqaataqaaaaaqaaavagnipgpgsvggiapaislsaaagigvd
dlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlhtmpiadpq

Sequence, based on observed residues (ATOM records):

>d1u7vb_ b.26.1.1 (B:) Smad4 tumor suppressor C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
isnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrt
eaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsa
yikvfdlrqchrqmqqqaataqaaaaaqigvddlrrlcilrmsfvkgwgpdyprqsiket
pcwieihlhralqlldevlhtmpiadpq

Timeline for d1u7vb_:

• d1u7vb_ first appeared in SCOP 1.69
  
• d1u7vb_ appears in SCOPe 2.05
  
• d1u7vb_ appears in SCOPe 2.07
  
• d1u7vb_ appears in the current release, SCOPe 2.08