Lineage for d1u7qa_ (1u7q A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007458Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 3007459Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 3007460Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 3007520Protein Potassium-transporting ATPase B chain, KdpB [111270] (1 species)
    minimal fold of this domain:
  7. 3007521Species Escherichia coli [TaxId:562] [111271] (5 PDB entries)
    Uniprot P03960 316-451
  8. 3007525Domain d1u7qa_: 1u7q A: [107728]

Details for d1u7qa_

PDB Entry: 1u7q (more details)

PDB Description: the solution structure of the nucleotide binding domain of kdpb
PDB Compounds: (A:) Potassium-transporting ATPase B chain

SCOPe Domain Sequences for d1u7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7qa_ d.220.1.1 (A:) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]}
nrqasefipaqgvdektladaaqlasladetpegrsivilakqrfnlrerdvqslhatfv
pftaqsrmsginidnrmirkgsvdairrhveangghfptdvdqkvdqvarqgatplvvve
gsrvlgvialkdivkg

SCOPe Domain Coordinates for d1u7qa_:

Click to download the PDB-style file with coordinates for d1u7qa_.
(The format of our PDB-style files is described here.)

Timeline for d1u7qa_: