Lineage for d1u7nb_ (1u7n B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138924Family c.77.1.4: PlsX-like [102660] (1 protein)
    Pfam PF02504; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and phosphotransacetylase families
  6. 2138925Protein Fatty acid/phospholipid synthesis protein PlsX [102661] (2 species)
  7. 2138929Species Enterococcus faecalis [TaxId:1351] [110716] (1 PDB entry)
    Uniprot Q82ZE8
  8. 2138931Domain d1u7nb_: 1u7n B: [107727]
    Structural genomics target
    complexed with edo, eoh

Details for d1u7nb_

PDB Entry: 1u7n (more details), 2.26 Å

PDB Description: Crystal Structure of the fatty acid/phospholipid synthesis protein PlsX from Enterococcus faecalis V583
PDB Compounds: (B:) Fatty acid/phospholipid synthesis protein plsX

SCOPe Domain Sequences for d1u7nb_:

Sequence, based on SEQRES records: (download)

>d1u7nb_ c.77.1.4 (B:) Fatty acid/phospholipid synthesis protein PlsX {Enterococcus faecalis [TaxId: 1351]}
mkiavdamggdnapqaivegvmlakqdfpdiefqlygkeaeikkyitdeknitiihtdek
iasddepvkairrkktasmvlaaqavkngeadaifsagntgallaaglfivgriknverp
glmstlpvmgepdkgfdmldlganadnkpehlvqyavlgsfyaekvrnvqnprvgllnng
teetkgseltkkafellaadetinfvgnvearellngvadvvvtdgftgnavlksiegta
mnmmsllktailsegvkgkmgalllknalhgmkdemdyskhggavlfglkapvikthgat
gpdavrytirqihtmletqvvpqlveyy

Sequence, based on observed residues (ATOM records): (download)

>d1u7nb_ c.77.1.4 (B:) Fatty acid/phospholipid synthesis protein PlsX {Enterococcus faecalis [TaxId: 1351]}
mkiavdamggdnapqaivegvmlakqdfpdiefqlygkeaeikkyitdeknitiihtdek
iaepvkairrkktasmvlaaqavkngeadaifsagntgallaaglfivgriknverpglm
stlpvmgepdkgfdmldlganadnkpehlvqyavlgsfyaekvrnvqnprvgllnngtee
tkgseltkkafellaadetinfvgnvearellngvadvvvtdgftgnavlksiegtamnm
msllktailsgalllknalhgmkdemdyskhggavlfglkapvikthgatgpdavrytir
qihtmletqvvpqlveyy

SCOPe Domain Coordinates for d1u7nb_:

Click to download the PDB-style file with coordinates for d1u7nb_.
(The format of our PDB-style files is described here.)

Timeline for d1u7nb_: