SCOP 1.71: Domain d1u7ia_: 1u7i A:

Lineage for d1u7ia_ (1u7i A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (9 families)

5. Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins)
   Pfam 06983; both variants of dimeric assembly are observed in the family (domain swapping)

6. Protein Hypothetical protein PA1358 [110884] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110885] (1 PDB entry)

8. Domain d1u7ia_: 1u7i A: [107724]

Details for d1u7ia_

PDB Entry: 1u7i, 1.4 Å

PDB Description: Crystal Structure of Protein of Unknown Function PA1358 from Pseudomonas aeruginosa

SCOP Domain Sequences for d1u7ia_:

Sequence; same for both SEQRES and ATOM records:

>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa}
hmsarvrpflmfqgvqaeaamnfylslfddaeilqiqrygaegpgpegsvlkalfrlgdq
svhcidshvrhafdftpafsffvdcesnaqierlaealsdggkalmplgdygfsqrfawl
adrfgvswqlnlag

Timeline for d1u7ia_:

• d1u7ia_ first appeared in SCOP 1.69
  
• d1u7ia_ appears in SCOP 1.73
  
• d1u7ia_ appears in the current release, SCOPe 2.08, called d1u7ia1