Lineage for d1u7ia_ (1u7i A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601425Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 601426Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (9 families) (S)
  5. 601653Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins)
    Pfam 06983; both variants of dimeric assembly are observed in the family (domain swapping)
  6. 601661Protein Hypothetical protein PA1358 [110884] (1 species)
  7. 601662Species Pseudomonas aeruginosa [TaxId:287] [110885] (1 PDB entry)
  8. 601663Domain d1u7ia_: 1u7i A: [107724]

Details for d1u7ia_

PDB Entry: 1u7i (more details), 1.4 Å

PDB Description: Crystal Structure of Protein of Unknown Function PA1358 from Pseudomonas aeruginosa

SCOP Domain Sequences for d1u7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa}
hmsarvrpflmfqgvqaeaamnfylslfddaeilqiqrygaegpgpegsvlkalfrlgdq
svhcidshvrhafdftpafsffvdcesnaqierlaealsdggkalmplgdygfsqrfawl
adrfgvswqlnlag

SCOP Domain Coordinates for d1u7ia_:

Click to download the PDB-style file with coordinates for d1u7ia_.
(The format of our PDB-style files is described here.)

Timeline for d1u7ia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u7ib_