Lineage for d1u7fc_ (1u7f C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459700Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 459701Superfamily b.26.1: SMAD/FHA domain [49879] (3 families) (S)
    has a few short helices inserted in loops
  5. 459702Family b.26.1.1: SMAD domain [49880] (4 proteins)
  6. 459714Protein Smad3 MH2 domain [82030] (1 species)
  7. 459715Species Human (Homo sapiens) [TaxId:9606] [82031] (4 PDB entries)
  8. 459718Domain d1u7fc_: 1u7f C: [107722]
    Other proteins in same PDB: d1u7fb_

Details for d1u7fc_

PDB Entry: 1u7f (more details), 2.6 Å

PDB Description: Crystal Structure of the phosphorylated Smad3/Smad4 heterotrimeric complex

SCOP Domain Sequences for d1u7fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7fc_ b.26.1.1 (C:) Smad3 MH2 domain {Human (Homo sapiens)}
afwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnrnaaveltrrh
igrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqefa
allaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwldk
vltqmgspsircssvs

SCOP Domain Coordinates for d1u7fc_:

Click to download the PDB-style file with coordinates for d1u7fc_.
(The format of our PDB-style files is described here.)

Timeline for d1u7fc_: