Lineage for d1u7fc_ (1u7f C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778064Family b.26.1.1: SMAD domain [49880] (5 proteins)
  6. 2778082Protein Smad3 MH2 domain [82030] (1 species)
  7. 2778083Species Human (Homo sapiens) [TaxId:9606] [82031] (4 PDB entries)
    Uniprot P84022 228-425
  8. 2778086Domain d1u7fc_: 1u7f C: [107722]
    Other proteins in same PDB: d1u7fb_

Details for d1u7fc_

PDB Entry: 1u7f (more details), 2.6 Å

PDB Description: Crystal Structure of the phosphorylated Smad3/Smad4 heterotrimeric complex
PDB Compounds: (C:) Mothers against decapentaplegic homolog 3

SCOPe Domain Sequences for d1u7fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7fc_ b.26.1.1 (C:) Smad3 MH2 domain {Human (Homo sapiens) [TaxId: 9606]}
afwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnrnaaveltrrh
igrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqefa
allaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwldk
vltqmgspsircssvs

SCOPe Domain Coordinates for d1u7fc_:

Click to download the PDB-style file with coordinates for d1u7fc_.
(The format of our PDB-style files is described here.)

Timeline for d1u7fc_: