Lineage for d1u7fb_ (1u7f B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555727Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 555728Superfamily b.26.1: SMAD/FHA domain [49879] (3 families) (S)
    has a few short helices inserted in loops
  5. 555729Family b.26.1.1: SMAD domain [49880] (4 proteins)
  6. 555749Protein Smad4 tumor suppressor C-terminal domain [49881] (1 species)
  7. 555750Species Human (Homo sapiens) [TaxId:9606] [49882] (6 PDB entries)
  8. 555758Domain d1u7fb_: 1u7f B: [107721]
    Other proteins in same PDB: d1u7fa_, d1u7fc_

Details for d1u7fb_

PDB Entry: 1u7f (more details), 2.6 Å

PDB Description: Crystal Structure of the phosphorylated Smad3/Smad4 heterotrimeric complex

SCOP Domain Sequences for d1u7fb_:

Sequence, based on SEQRES records: (download)

>d1u7fb_ b.26.1.1 (B:) Smad4 tumor suppressor C-terminal domain {Human (Homo sapiens)}
isnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrt
eaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsa
yikvfdlrqchrqmqqqaataqaaaaaqaaavagnipgpgsvggiapaislsaaagigvd
dlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlhtmpia

Sequence, based on observed residues (ATOM records): (download)

>d1u7fb_ b.26.1.1 (B:) Smad4 tumor suppressor C-terminal domain {Human (Homo sapiens)}
isnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrt
eaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldredavhkiypsayikvfd
lrqchrqmqqqaataqigvddlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhral
qlldevlhtmpia

SCOP Domain Coordinates for d1u7fb_:

Click to download the PDB-style file with coordinates for d1u7fb_.
(The format of our PDB-style files is described here.)

Timeline for d1u7fb_: