SCOP 1.69: Domain d1u7fa_: 1u7f A:

Lineage for d1u7fa_ (1u7f A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (3 families)
   has a few short helices inserted in loops

5. Family b.26.1.1: SMAD domain [49880] (4 proteins)

6. Protein Smad3 MH2 domain [82030] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82031] (4 PDB entries)

8. Domain d1u7fa_: 1u7f A: [107720]
   Other proteins in same PDB: d1u7fb_

Details for d1u7fa_

PDB Entry: 1u7f, 2.6 Å

PDB Description: Crystal Structure of the phosphorylated Smad3/Smad4 heterotrimeric complex

SCOP Domain Sequences for d1u7fa_:

Sequence; same for both SEQRES and ATOM records:

>d1u7fa_ b.26.1.1 (A:) Smad3 MH2 domain {Human (Homo sapiens)}
epafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnrnaaveltr
rhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqe
faallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwl
dkvltqmgspsircssvs

Timeline for d1u7fa_:

• d1u7fa_ is new in SCOP 1.69
  
• d1u7fa_ appears in SCOP 1.71
  
• d1u7fa_ appears in the current release, SCOPe 2.08