Lineage for d1u7ca_ (1u7c A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028524Fold f.44: Ammonium transporter [111351] (1 superfamily)
    11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix
  4. 3028525Superfamily f.44.1: Ammonium transporter [111352] (2 families) (S)
    automatically mapped to Pfam PF00909
  5. 3028526Family f.44.1.1: Ammonium transporter [111353] (1 protein)
    Pfam PF00909
  6. 3028527Protein Ammonium transporter AmtB [111354] (1 species)
  7. 3028528Species Escherichia coli [TaxId:562] [111355] (5 PDB entries)
    Uniprot P37905 2-407
  8. 3028530Domain d1u7ca_: 1u7c A: [107719]
    complexed with nme

Details for d1u7ca_

PDB Entry: 1u7c (more details), 1.85 Å

PDB Description: crystal structure of amtb from e.coli with methyl ammonium.
PDB Compounds: (A:) Probable ammonium transporter

SCOPe Domain Sequences for d1u7ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7ca_ f.44.1.1 (A:) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]}
avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy
gyslasgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer
irfpavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli
gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai
lgwifgewalrglpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml
krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait
ivwsgvvafigykladltvglrv

SCOPe Domain Coordinates for d1u7ca_:

Click to download the PDB-style file with coordinates for d1u7ca_.
(The format of our PDB-style files is described here.)

Timeline for d1u7ca_: