![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.44: Ammonium transporter [111351] (1 superfamily) 11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix |
![]() | Superfamily f.44.1: Ammonium transporter [111352] (2 families) ![]() automatically mapped to Pfam PF00909 |
![]() | Family f.44.1.1: Ammonium transporter [111353] (1 protein) Pfam PF00909 |
![]() | Protein Ammonium transporter AmtB [111354] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [111355] (5 PDB entries) Uniprot P37905 2-407 |
![]() | Domain d1u7ca_: 1u7c A: [107719] complexed with nme |
PDB Entry: 1u7c (more details), 1.85 Å
SCOPe Domain Sequences for d1u7ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u7ca_ f.44.1.1 (A:) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]} avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy gyslasgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer irfpavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai lgwifgewalrglpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait ivwsgvvafigykladltvglrv
Timeline for d1u7ca_: