SCOPe 2.06: Domain d1u79e_: 1u79 E:

Lineage for d1u79e_ (1u79 E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FKBP13 [110870] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110871] (2 PDB entries)
   Uniprot Q9SCY2 84-208

8. Domain d1u79e_: 1u79 E: [107718]

Details for d1u79e_

PDB Entry: 1u79, 1.85 Å

PDB Description: Crystal structure of AtFKBP13

PDB Compounds: (E:) FKBP-type peptidyl-prolyl cis-trans isomerase 3

SCOPe Domain Sequences for d1u79e_:

Sequence; same for both SEQRES and ATOM records:

>d1u79e_ d.26.1.1 (E:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
yigka

Timeline for d1u79e_:

• d1u79e_ first appeared in SCOP 1.69
  
• d1u79e_ appears in SCOPe 2.05
  
• d1u79e_ appears in SCOPe 2.07
  
• d1u79e_ appears in the current release, SCOPe 2.08