Lineage for d1u79d_ (1u79 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548477Protein FKBP13 [110870] (1 species)
  7. 2548478Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110871] (2 PDB entries)
    Uniprot Q9SCY2 84-208
  8. 2548482Domain d1u79d_: 1u79 D: [107717]

Details for d1u79d_

PDB Entry: 1u79 (more details), 1.85 Å

PDB Description: Crystal structure of AtFKBP13
PDB Compounds: (D:) FKBP-type peptidyl-prolyl cis-trans isomerase 3

SCOPe Domain Sequences for d1u79d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u79d_ d.26.1.1 (D:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
yigka

SCOPe Domain Coordinates for d1u79d_:

Click to download the PDB-style file with coordinates for d1u79d_.
(The format of our PDB-style files is described here.)

Timeline for d1u79d_: