Lineage for d1u78a1 (1u78 A:2-54)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981785Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 1981818Protein Transposase tc3a1-65 [46733] (1 species)
  7. 1981819Species Nematode (Caenorhabditis elegans) [TaxId:6239] [46734] (2 PDB entries)
    Uniprot P34257 2-104
  8. 1981821Domain d1u78a1: 1u78 A:2-54 [107712]
    protein/DNA complex

Details for d1u78a1

PDB Entry: 1u78 (more details), 2.69 Å

PDB Description: structure of the bipartite dna-binding domain of tc3 transposase bound to transposon dna
PDB Compounds: (A:) transposable element tc3 transposase

SCOPe Domain Sequences for d1u78a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u78a1 a.4.1.2 (A:2-54) Transposase tc3a1-65 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
prgsalsdteraqldvmkllnvslhemsrkisrsrhcirvylkdpvsygtskr

SCOPe Domain Coordinates for d1u78a1:

Click to download the PDB-style file with coordinates for d1u78a1.
(The format of our PDB-style files is described here.)

Timeline for d1u78a1: