Lineage for d1u77a_ (1u77 A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256200Fold f.44: Ammonium transporter [111351] (1 superfamily)
    11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix
  4. 2256201Superfamily f.44.1: Ammonium transporter [111352] (2 families) (S)
    automatically mapped to Pfam PF00909
  5. 2256202Family f.44.1.1: Ammonium transporter [111353] (1 protein)
    Pfam PF00909
  6. 2256203Protein Ammonium transporter AmtB [111354] (1 species)
  7. 2256204Species Escherichia coli [TaxId:562] [111355] (5 PDB entries)
    Uniprot P37905 2-407
  8. 2256209Domain d1u77a_: 1u77 A: [107711]

Details for d1u77a_

PDB Entry: 1u77 (more details), 2 Å

PDB Description: crystal structure of ammonia channel amtb from e. coli
PDB Compounds: (A:) Probable ammonium transporter

SCOPe Domain Sequences for d1u77a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u77a_ f.44.1.1 (A:) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]}
avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy
gyslasgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer
irfpavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli
gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai
lgwifgewalrglpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml
krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait
ivwsgvvafigykladltvglrv

SCOPe Domain Coordinates for d1u77a_:

Click to download the PDB-style file with coordinates for d1u77a_.
(The format of our PDB-style files is described here.)

Timeline for d1u77a_: