![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
![]() | Protein Mitochondrial cytochrome c [46642] (6 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [46644] (16 PDB entries) |
![]() | Domain d1u75b_: 1u75 B: [107709] Other proteins in same PDB: d1u75a_, d1u75c_ |
PDB Entry: 1u75 (more details), 2.55 Å
SCOP Domain Sequences for d1u75b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u75b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Horse (Equus caballus)} gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgftytdanknkgitwk eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne
Timeline for d1u75b_: