![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Mitochondrial cytochrome c [46642] (6 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (52 PDB entries) Uniprot P00044 |
![]() | Domain d1u74d_: 1u74 D: [107707] Other proteins in same PDB: d1u74a_, d1u74c_ complexed with hem, po4, znh |
PDB Entry: 1u74 (more details), 2.4 Å
SCOPe Domain Sequences for d1u74d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u74d_ a.3.1.1 (D:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase
Timeline for d1u74d_: