Class a: All alpha proteins [46456] (258 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
Protein Mitochondrial cytochrome c [46642] (6 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (39 PDB entries) |
Domain d1u74b_: 1u74 B: [107705] Other proteins in same PDB: d1u74a_, d1u74c_ |
PDB Entry: 1u74 (more details), 2.4 Å
SCOP Domain Sequences for d1u74b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u74b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase
Timeline for d1u74b_: