Lineage for d1u74b_ (1u74 B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437666Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 437667Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 437668Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 437826Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 437827Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (35 PDB entries)
  8. 437856Domain d1u74b_: 1u74 B: [107705]
    Other proteins in same PDB: d1u74a_, d1u74c_

Details for d1u74b_

PDB Entry: 1u74 (more details), 2.4 Å

PDB Description: electron transfer complex between cytochrome c and cytochrome c peroxidase

SCOP Domain Sequences for d1u74b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u74b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase

SCOP Domain Coordinates for d1u74b_:

Click to download the PDB-style file with coordinates for d1u74b_.
(The format of our PDB-style files is described here.)

Timeline for d1u74b_: