Lineage for d1u74b_ (1u74 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. Protein Mitochondrial cytochrome c [46642] (7 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (90 PDB entries)
    Uniprot P00044
  8. Domain d1u74b_: 1u74 B: [107705]
    Other proteins in same PDB: d1u74a_, d1u74c1, d1u74c2
    complexed with hem, po4, znh

Details for d1u74b_

PDB Entry: 1u74 (more details), 2.4 Å

PDB Description: Electron Transfer Complex between cytochrome C and cytochrome C peroxidase
PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d1u74b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u74b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase

SCOPe Domain Coordinates for d1u74b_ are not available.

Timeline for d1u74b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u74a_, d1u74c1, d1u74c2, d1u74d_