Lineage for d1u69d_ (1u69 D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601425Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 601426Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (9 families) (S)
  5. 601653Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins)
    Pfam 06983; both variants of dimeric assembly are observed in the family (domain swapping)
  6. 601665Protein Hypothetical protein PA2721 [110886] (1 species)
  7. 601666Species Pseudomonas aeruginosa [TaxId:287] [110887] (1 PDB entry)
  8. 601670Domain d1u69d_: 1u69 D: [107702]
    Structural genomics target

Details for d1u69d_

PDB Entry: 1u69 (more details), 1.6 Å

PDB Description: Crystal Structure of PA2721 Protein of Unknown Function from Pseudomonas aeruginosa PAO1

SCOP Domain Sequences for d1u69d_:

Sequence, based on SEQRES records: (download)

>d1u69d_ d.32.1.7 (D:) Hypothetical protein PA2721 {Pseudomonas aeruginosa}
sknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmgipcl
glnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprv
lseaiaspdraaarrafeammtmgridiatiekafk

Sequence, based on observed residues (ATOM records): (download)

>d1u69d_ d.32.1.7 (D:) Hypothetical protein PA2721 {Pseudomonas aeruginosa}
sknticlwydsaaleaatfyaetfpdsavlavhrapdvltvefrvmgipclglnggpafr
hseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprvlseaiaspd
raaarrafeammtmgridiatiekafk

SCOP Domain Coordinates for d1u69d_:

Click to download the PDB-style file with coordinates for d1u69d_.
(The format of our PDB-style files is described here.)

Timeline for d1u69d_: