SCOP 1.73: Domain d1u69c_: 1u69 C:

Lineage for d1u69c_ (1u69 C:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families)

5. Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins)
   Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping)

6. Protein Hypothetical protein PA2721 [110886] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110887] (1 PDB entry)

8. Domain d1u69c_: 1u69 C: [107701]

Details for d1u69c_

PDB Entry: 1u69, 1.6 Å

PDB Description: Crystal Structure of PA2721 Protein of Unknown Function from Pseudomonas aeruginosa PAO1

PDB Compounds: (C:) hypothetical protein

SCOP Domain Sequences for d1u69c_:

Sequence, based on SEQRES records:

>d1u69c_ d.32.1.7 (C:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]}
sknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmgipcl
glnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprv
lseaiaspdraaarrafeammtmgridiatiekafk

Sequence, based on observed residues (ATOM records):

>d1u69c_ d.32.1.7 (C:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]}
sknticlwydsaaleaatfyaetfpdsavlavhrapgdvltvefrvmgipclglnggpaf
rhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprvlseaiasp
draaarrafeammtmgridiatiekafk

Timeline for d1u69c_:

• d1u69c_ first appeared in SCOP 1.69
  
• d1u69c_ appears in SCOP 1.71
  
• d1u69c_ appears in SCOP 1.75
  
• d1u69c_ appears in the current release, SCOPe 2.08