Lineage for d1u69c_ (1u69 C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502238Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 502239Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families) (S)
  5. 502460Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase (Pfam 06983) [110883] (2 proteins)
  6. 502465Protein Hypothetical protein PA2721 [110886] (1 species)
  7. 502466Species Pseudomonas aeruginosa [TaxId:287] [110887] (1 PDB entry)
  8. 502469Domain d1u69c_: 1u69 C: [107701]

Details for d1u69c_

PDB Entry: 1u69 (more details), 1.6 Å

PDB Description: Crystal Structure of PA2721 Protein of Unknown Function from Pseudomonas aeruginosa PAO1

SCOP Domain Sequences for d1u69c_:

Sequence, based on SEQRES records: (download)

>d1u69c_ d.32.1.7 (C:) Hypothetical protein PA2721 {Pseudomonas aeruginosa}
sknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmgipcl
glnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprv
lseaiaspdraaarrafeammtmgridiatiekafk

Sequence, based on observed residues (ATOM records): (download)

>d1u69c_ d.32.1.7 (C:) Hypothetical protein PA2721 {Pseudomonas aeruginosa}
sknticlwydsaaleaatfyaetfpdsavlavhrapgdvltvefrvmgipclglnggpaf
rhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprvlseaiasp
draaarrafeammtmgridiatiekafk

SCOP Domain Coordinates for d1u69c_:

Click to download the PDB-style file with coordinates for d1u69c_.
(The format of our PDB-style files is described here.)

Timeline for d1u69c_: