![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins) Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping) |
![]() | Protein Hypothetical protein PA2721 [110886] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [110887] (1 PDB entry) Uniprot Q9I0C1 |
![]() | Domain d1u69c_: 1u69 C: [107701] Structural genomics target |
PDB Entry: 1u69 (more details), 1.6 Å
SCOPe Domain Sequences for d1u69c_:
Sequence, based on SEQRES records: (download)
>d1u69c_ d.32.1.7 (C:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} sknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmgipcl glnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprv lseaiaspdraaarrafeammtmgridiatiekafk
>d1u69c_ d.32.1.7 (C:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} sknticlwydsaaleaatfyaetfpdsavlavhrapgdvltvefrvmgipclglnggpaf rhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprvlseaiasp draaarrafeammtmgridiatiekafk
Timeline for d1u69c_: