![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families) ![]() |
![]() | Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase (Pfam 06983) [110883] (2 proteins) |
![]() | Protein Hypothetical protein PA2721 [110886] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [110887] (1 PDB entry) |
![]() | Domain d1u69b_: 1u69 B: [107700] |
PDB Entry: 1u69 (more details), 1.6 Å
SCOP Domain Sequences for d1u69b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u69b_ d.32.1.7 (B:) Hypothetical protein PA2721 {Pseudomonas aeruginosa} sknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmgipcl glnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprv lseaiaspdraaarrafeammtmgridiatiekafk
Timeline for d1u69b_: