Lineage for d1u69b_ (1u69 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942843Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins)
    Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping)
  6. 2942855Protein Hypothetical protein PA2721 [110886] (1 species)
  7. 2942856Species Pseudomonas aeruginosa [TaxId:287] [110887] (1 PDB entry)
    Uniprot Q9I0C1
  8. 2942858Domain d1u69b_: 1u69 B: [107700]
    Structural genomics target

Details for d1u69b_

PDB Entry: 1u69 (more details), 1.6 Å

PDB Description: Crystal Structure of PA2721 Protein of Unknown Function from Pseudomonas aeruginosa PAO1
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1u69b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u69b_ d.32.1.7 (B:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]}
sknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmgipcl
glnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprv
lseaiaspdraaarrafeammtmgridiatiekafk

SCOPe Domain Coordinates for d1u69b_:

Click to download the PDB-style file with coordinates for d1u69b_.
(The format of our PDB-style files is described here.)

Timeline for d1u69b_: