Lineage for d1u67a1 (1u67 A:74-584)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541091Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 541092Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 541292Family a.93.1.2: Myeloperoxidase-like [48132] (2 proteins)
  6. 541312Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. 541342Species Sheep (Ovis aries) [TaxId:9940] [48137] (17 PDB entries)
  8. 541363Domain d1u67a1: 1u67 A:74-584 [107697]
    Other proteins in same PDB: d1u67a2
    complexed with acd, bma, bog, coh, nag; mutant

Details for d1u67a1

PDB Entry: 1u67 (more details), 3.1 Å

PDB Description: crystal structure of arachidonic acid bound to a mutant of prostagladin h synthase-1 that forms predominantly 11-hpete.

SCOP Domain Sequences for d1u67a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u67a1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries)}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyaqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhfhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvpd

SCOP Domain Coordinates for d1u67a1:

Click to download the PDB-style file with coordinates for d1u67a1.
(The format of our PDB-style files is described here.)

Timeline for d1u67a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u67a2