Lineage for d1u67a1 (1u67 A:74-584)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002843Family a.93.1.2: Myeloperoxidase-like [48132] (3 protein domains)
  6. 2002863Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. 2002906Species Sheep (Ovis aries) [TaxId:9940] [48137] (23 PDB entries)
    Uniprot P05979 32-584
  8. 2002939Domain d1u67a1: 1u67 A:74-584 [107697]
    Other proteins in same PDB: d1u67a2
    complexed with acd, bog, coh; mutant

Details for d1u67a1

PDB Entry: 1u67 (more details), 3.1 Å

PDB Description: Crystal Structure of Arachidonic Acid Bound to a Mutant of Prostagladin H Synthase-1 that Forms Predominantly 11-HPETE.
PDB Compounds: (A:) Prostaglandin G/H synthase 1 precursor

SCOPe Domain Sequences for d1u67a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u67a1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyaqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhfhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvpd

SCOPe Domain Coordinates for d1u67a1:

Click to download the PDB-style file with coordinates for d1u67a1.
(The format of our PDB-style files is described here.)

Timeline for d1u67a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u67a2