Lineage for d1u61a_ (1u61 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779052Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 779053Superfamily a.149.1: RNase III domain-like [69065] (2 families) (S)
  5. 779054Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 779055Protein Hypothetical protein BC0111 [109892] (1 species)
  7. 779056Species Bacillus cereus [TaxId:1396] [109893] (1 PDB entry)
    Uniprot Q81J58
  8. 779057Domain d1u61a_: 1u61 A: [107696]
    Structural genomics target

Details for d1u61a_

PDB Entry: 1u61 (more details), 2.15 Å

PDB Description: Crystal Structure of Putative Ribonuclease III from Bacillus cereus
PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d1u61a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u61a_ a.149.1.1 (A:) Hypothetical protein BC0111 {Bacillus cereus [TaxId: 1396]}
idakqlnslalaymgdavyeqyiryhllqkgkvrpnqlhrlgtsfvsakaqakvvyhlle
taflteeeeavlrrgrnansgtvpkntdvqtyrhstafealigyhhllnnrerldeivyk
aiavlee

SCOP Domain Coordinates for d1u61a_:

Click to download the PDB-style file with coordinates for d1u61a_.
(The format of our PDB-style files is described here.)

Timeline for d1u61a_: