Lineage for d1u60b_ (1u60 B:)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742172Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 742173Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 742564Family e.3.1.2: Glutaminase [90084] (2 proteins)
    Pfam PF04960
  6. 742565Protein Probable glutaminase YbaS [111291] (1 species)
  7. 742566Species Escherichia coli [TaxId:562] [111292] (1 PDB entry)
  8. 742568Domain d1u60b_: 1u60 B: [107693]

Details for d1u60b_

PDB Entry: 1u60 (more details), 1.61 Å

PDB Description: MCSG APC5046 Probable glutaminase ybaS
PDB Compounds: (B:) Probable glutaminase ybaS

SCOP Domain Sequences for d1u60b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u60b_ e.3.1.2 (B:) Probable glutaminase YbaS {Escherichia coli [TaxId: 562]}
ldanklqqavdqaytqfhslnggqnadyipflanvpgqlaavaivtcdgnvysagdsdyr
falesiskvctlalaledvgpqavqdkigadptglpfnsvialelhggkplsplvnagai
attslinaenveqrwqrilhiqqqlageqvalsdevnqseqttnfhnraiawllysagyl
ycdameacdvytrqcstllntielatlgatlaaggvnplthkrvlqadnvpyilaemmme
glygrsgdwayrvglpgksgvgggilavvpgvmgiaafsppldedgnsvrgqkmvasvak
qlgynvfkg

SCOP Domain Coordinates for d1u60b_:

Click to download the PDB-style file with coordinates for d1u60b_.
(The format of our PDB-style files is described here.)

Timeline for d1u60b_: