Lineage for d1u60b_ (1u60 B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014011Family e.3.1.2: Glutaminase [90084] (2 proteins)
    Pfam PF04960
  6. 3014012Protein Probable glutaminase YbaS [111291] (1 species)
  7. 3014013Species Escherichia coli [TaxId:562] [111292] (1 PDB entry)
    Uniprot P77454
  8. 3014015Domain d1u60b_: 1u60 B: [107693]
    complexed with edo, fmt

Details for d1u60b_

PDB Entry: 1u60 (more details), 1.61 Å

PDB Description: MCSG APC5046 Probable glutaminase ybaS
PDB Compounds: (B:) Probable glutaminase ybaS

SCOPe Domain Sequences for d1u60b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u60b_ e.3.1.2 (B:) Probable glutaminase YbaS {Escherichia coli [TaxId: 562]}
ldanklqqavdqaytqfhslnggqnadyipflanvpgqlaavaivtcdgnvysagdsdyr
falesiskvctlalaledvgpqavqdkigadptglpfnsvialelhggkplsplvnagai
attslinaenveqrwqrilhiqqqlageqvalsdevnqseqttnfhnraiawllysagyl
ycdameacdvytrqcstllntielatlgatlaaggvnplthkrvlqadnvpyilaemmme
glygrsgdwayrvglpgksgvgggilavvpgvmgiaafsppldedgnsvrgqkmvasvak
qlgynvfkg

SCOPe Domain Coordinates for d1u60b_:

Click to download the PDB-style file with coordinates for d1u60b_.
(The format of our PDB-style files is described here.)

Timeline for d1u60b_: