SCOP 1.69: Domain d1u5tb2: 1u5t B:490-564

Lineage for d1u5tb2 (1u5t B:490-564)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
   duplication: tandem repeat of two "winged-helix" domains

6. Protein Vacuolar protein sorting-associated protein VPS36 [109695] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109696] (1 PDB entry)

8. Domain d1u5tb2: 1u5t B:490-564 [107687]
   Other proteins in same PDB: d1u5ta1, d1u5ta2, d1u5tc1, d1u5tc2, d1u5td1, d1u5td2

Details for d1u5tb2

PDB Entry: 1u5t, 3.6 Å

PDB Description: Structure of the ESCRT-II endosomal trafficking complex

SCOP Domain Sequences for d1u5tb2:

Sequence; same for both SEQRES and ATOM records:

>d1u5tb2 a.4.5.54 (B:490-564) Vacuolar protein sorting-associated protein VPS36 {Baker's yeast (Saccharomyces cerevisiae)}
ekfdvvkeklvdligdnpgsdllrltqilssnnsksnwtlgilmevlqncvdegdllidk
qlsgiyyyknsywps

Timeline for d1u5tb2:

• d1u5tb2 is new in SCOP 1.69
  
• d1u5tb2 appears in SCOP 1.71
  
• d1u5tb2 appears in the current release, SCOPe 2.08