Lineage for d1u5ja2 (1u5j A:4-306)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 817252Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 817906Family c.1.10.5: HMGL-like [89494] (3 proteins)
    Pfam PF00682
  6. 817917Protein Transcarboxylase 5S subunit, N-terminal domain [110366] (1 species)
  7. 817918Species Propionibacterium freudenreichii shermanii [TaxId:1752] [110367] (6 PDB entries)
    Uniprot Q70AC7 3-474
  8. 817924Domain d1u5ja2: 1u5j A:4-306 [107683]
    Other proteins in same PDB: d1u5ja1
    complexed with co; mutant

Details for d1u5ja2

PDB Entry: 1u5j (more details), 2.8 Å

PDB Description: propionibacterium shermanii transcarboxylase 5s subunit, met186ile
PDB Compounds: (A:) transcarboxylase 5S subunit

SCOP Domain Sequences for d1u5ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5ja2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]}
reievseprevgitelvlrdahqslmatrmamedmvgacadidaagywsvecwggatyds
cirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvdrfvdksaengmdvf
rvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvklagqlldmgadsial
kdiaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmkaieagvdvvdtais
smslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpkykkfesktlvdtsif
ksq

SCOP Domain Coordinates for d1u5ja2:

Click to download the PDB-style file with coordinates for d1u5ja2.
(The format of our PDB-style files is described here.)

Timeline for d1u5ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u5ja1