![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.7: post-HMGL domain-like [89000] (3 families) ![]() |
![]() | Family a.5.7.2: Conserved carboxylase domain [109725] (1 protein) Pfam PF02436 duplication: contains two domains of this fold, connected with a helical linker |
![]() | Protein Transcarboxylase 5S subunit, C-terminal domain [109726] (1 species) |
![]() | Species Propionibacterium freudenreichii shermanii [TaxId:1752] [109727] (6 PDB entries) Uniprot Q70AC7 3-474; d1: 307-367; d2: 416-459 |
![]() | Domain d1u5ja1: 1u5j A:307-474 [107682] Other proteins in same PDB: d1u5ja2 complexed with co |
PDB Entry: 1u5j (more details), 2.8 Å
SCOPe Domain Sequences for d1u5ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5ja1 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} ipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfnvmmg eykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekqskea atlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea
Timeline for d1u5ja1: