Lineage for d1u5ja1 (1u5j A:307-474)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696293Superfamily a.5.7: post-HMGL domain-like [89000] (3 families) (S)
  5. 2696305Family a.5.7.2: Conserved carboxylase domain [109725] (1 protein)
    Pfam PF02436
    duplication: contains two domains of this fold, connected with a helical linker
  6. 2696306Protein Transcarboxylase 5S subunit, C-terminal domain [109726] (1 species)
  7. 2696307Species Propionibacterium freudenreichii shermanii [TaxId:1752] [109727] (6 PDB entries)
    Uniprot Q70AC7 3-474; d1: 307-367; d2: 416-459
  8. 2696313Domain d1u5ja1: 1u5j A:307-474 [107682]
    Other proteins in same PDB: d1u5ja2
    complexed with co

Details for d1u5ja1

PDB Entry: 1u5j (more details), 2.8 Å

PDB Description: propionibacterium shermanii transcarboxylase 5s subunit, met186ile
PDB Compounds: (A:) transcarboxylase 5S subunit

SCOPe Domain Sequences for d1u5ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5ja1 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]}
ipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfnvmmg
eykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekqskea
atlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea

SCOPe Domain Coordinates for d1u5ja1:

Click to download the PDB-style file with coordinates for d1u5ja1.
(The format of our PDB-style files is described here.)

Timeline for d1u5ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u5ja2