Lineage for d1u59a1 (1u59 A:328-606)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983231Protein Tyrosine-protein kinase ZAP-70 [111198] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 2983232Species Human (Homo sapiens) [TaxId:9606] [111199] (1 PDB entry)
    Uniprot P43403 328-606 # structure of the N-terminal SH2 domains (1-132;133-256) is also known: 1m61 (89997)
  8. 2983233Domain d1u59a1: 1u59 A:328-606 [107681]
    Other proteins in same PDB: d1u59a2
    complexed with stu

Details for d1u59a1

PDB Entry: 1u59 (more details), 2.3 Å

PDB Description: crystal structure of the zap-70 kinase domain in complex with staurosporine
PDB Compounds: (A:) tyrosine-protein kinase zap-70

SCOPe Domain Sequences for d1u59a1:

Sequence, based on SEQRES records: (download)

>d1u59a1 d.144.1.7 (A:328-606) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]}
kklflkrdnlliadielgcgnfgsvrqgvyrmrkkqidvaikvlkqgtekadteemmrea
qimhqldnpyivrligvcqaealmlvmemagggplhkflvgkreeipvsnvaellhqvsm
gmkyleeknfvhrdlaarnvllvnrhyakisdfglskalgaddsyytarsagkwplkwya
pecinfrkfssrsdvwsygvtmwealsygqkpykkmkgpevmafieqgkrmecppecppe
lyalmsdcwiykwedrpdfltveqrmracyyslaskveg

Sequence, based on observed residues (ATOM records): (download)

>d1u59a1 d.144.1.7 (A:328-606) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]}
kklflkrdnlliadielgcgnfgsvrqgvyrkqidvaikvlkqgtekadteemmreaqim
hqldnpyivrligvcqaealmlvmemagggplhkflvgkreeipvsnvaellhqvsmgmk
yleeknfvhrdlaarnvllvnrhyakisdfglskalgaddsyytarsagkwplkwyapec
infrkfssrsdvwsygvtmwealsygqkpykkmkgpevmafieqgkrmecppecppelya
lmsdcwiykwedrpdfltveqrmracyyslaskveg

SCOPe Domain Coordinates for d1u59a1:

Click to download the PDB-style file with coordinates for d1u59a1.
(The format of our PDB-style files is described here.)

Timeline for d1u59a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u59a2