![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily) an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity |
![]() | Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (2 families) ![]() |
![]() | Family d.278.1.1: H-NOX domain [111127] (1 protein) binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains |
![]() | Protein Methyl-accepting chemotaxis protein [111128] (1 species) |
![]() | Species Thermoanaerobacter tengcongensis [111129] (4 PDB entries) |
![]() | Domain d1u56b_: 1u56 B: [107680] complexed with cl, hem |
PDB Entry: 1u56 (more details), 1.9 Å
SCOP Domain Sequences for d1u56b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u56b_ d.278.1.1 (B:) Methyl-accepting chemotaxis protein {Thermoanaerobacter tengcongensis} mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn pvf
Timeline for d1u56b_: