Lineage for d1u55a_ (1u55 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 517006Fold d.278: H-NOX domain [111125] (1 superfamily)
    binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains
  4. 517007Superfamily d.278.1: H-NOX domain [111126] (1 family) (S)
  5. 517008Family d.278.1.1: H-NOX domain [111127] (1 protein)
  6. 517009Protein Methyl-accepting chemotaxis protein [111128] (1 species)
  7. 517010Species Thermoanaerobacter tengcongensis [111129] (4 PDB entries)
  8. 517011Domain d1u55a_: 1u55 A: [107677]

Details for d1u55a_

PDB Entry: 1u55 (more details), 1.77 Å

PDB Description: Crystal structure of an oxygen binding H-NOX domain related to soluble guanylate cyclases (oxygen complex)

SCOP Domain Sequences for d1u55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u55a_ d.278.1.1 (A:) Methyl-accepting chemotaxis protein {Thermoanaerobacter tengcongensis}
mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
pvfeykkn

SCOP Domain Coordinates for d1u55a_:

Click to download the PDB-style file with coordinates for d1u55a_.
(The format of our PDB-style files is described here.)

Timeline for d1u55a_: