Lineage for d1u54a_ (1u54 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512001Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 512025Protein Activated CDC42 kinase 1, ACK1 [111200] (1 species)
    PTK group; Tck subfamily; non-membrane spanning protein tyrosine kinase
  7. 512026Species Human (Homo sapiens) [TaxId:9606] [111201] (3 PDB entries)
  8. 512031Domain d1u54a_: 1u54 A: [107675]

Details for d1u54a_

PDB Entry: 1u54 (more details), 2.8 Å

PDB Description: Crystal Structures of the Phosphorylated and Unphosphorylated Kinase Domains of the CDC42-associated Tyrosine Kinase ACK1 bound to AMP-PCP

SCOP Domain Sequences for d1u54a_:

Sequence, based on SEQRES records: (download)

>d1u54a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens)}
qsltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddf
irevnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryav
qvaegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpf
awcapeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpe
dcpqdiynvmvqcwahkpedrptfvalrdflleaqp

Sequence, based on observed residues (ATOM records): (download)

>d1u54a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens)}
qsltcligekdlrlleklgdgvvrrgewdapsgktvsvavkclamddfirevnamhsldh
rnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgylesk
rfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrvpfawcapeslktrtf
shasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqc
wahkpedrptfvalrdflleaqp

SCOP Domain Coordinates for d1u54a_:

Click to download the PDB-style file with coordinates for d1u54a_.
(The format of our PDB-style files is described here.)

Timeline for d1u54a_: