Lineage for d1u4jb_ (1u4j B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011697Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2011698Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2011703Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2011813Protein Snake phospholipase A2 [48624] (37 species)
  7. 2011908Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries)
    Uniprot Q6SLM1 # fragment; Uniprot Q9DF52 28-145 # ! 74% sequence identity
  8. 2011910Domain d1u4jb_: 1u4j B: [107674]
    complexed with acy, cl, man, na

Details for d1u4jb_

PDB Entry: 1u4j (more details), 2.18 Å

PDB Description: Crystal structure of a carbohydrate induced dimer of group I phospholipase A2 from Bungarus caeruleus at 2.1 A resolution
PDB Compounds: (B:) Phospholipase A2 isoform 2

SCOPe Domain Sequences for d1u4jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4jb_ a.133.1.2 (B:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]}
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq

SCOPe Domain Coordinates for d1u4jb_:

Click to download the PDB-style file with coordinates for d1u4jb_.
(The format of our PDB-style files is described here.)

Timeline for d1u4jb_: