![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.278: H-NOX domain [111125] (1 superfamily) binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains |
![]() | Superfamily d.278.1: H-NOX domain [111126] (1 family) ![]() |
![]() | Family d.278.1.1: H-NOX domain [111127] (1 protein) |
![]() | Protein Methyl-accepting chemotaxis protein [111128] (1 species) |
![]() | Species Thermoanaerobacter tengcongensis [111129] (4 PDB entries) |
![]() | Domain d1u4hb_: 1u4h B: [107672] |
PDB Entry: 1u4h (more details), 2.07 Å
SCOP Domain Sequences for d1u4hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u4hb_ d.278.1.1 (B:) Methyl-accepting chemotaxis protein {Thermoanaerobacter tengcongensis} mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn pvfeykkn
Timeline for d1u4hb_: