Lineage for d1u4ga_ (1u4g A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507855Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 507856Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 507862Family d.92.1.2: Thermolysin-like [55490] (4 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 507866Protein Elastase [63413] (1 species)
  7. 507867Species Pseudomonas aeruginosa [TaxId:287] [55492] (2 PDB entries)
  8. 507868Domain d1u4ga_: 1u4g A: [107670]

Details for d1u4ga_

PDB Entry: 1u4g (more details), 1.4 Å

PDB Description: Elastase of Pseudomonas aeruginosa with an inhibitor

SCOP Domain Sequences for d1u4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4ga_ d.92.1.2 (A:) Elastase {Pseudomonas aeruginosa}
aeaggpggnqkigkytygsdygplivndrcemddgnvitvdmnsstddskttpfrfacpt
ntykqvngaysplndahffggvvfklyrdwfgtsplthklymkvhygrsvenaywdgtam
lfgdgatmfyplvsldvaahevshgfteqnsgliyrgqsggmneafsdmageaaefymrg
kndfligydikkgsgalrymdqpsrdgrsidnasqyyngidvhhssgvynrafyllansp
gwdtrkafevfvdanryywtatsnynsgacgvirsaqnrnysaadvtrafstvgvtcp

SCOP Domain Coordinates for d1u4ga_:

Click to download the PDB-style file with coordinates for d1u4ga_.
(The format of our PDB-style files is described here.)

Timeline for d1u4ga_: