Lineage for d1u4db_ (1u4d B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734740Protein Activated CDC42 kinase 1, ACK1 [111200] (1 species)
    PTK group; Tck subfamily; non-membrane spanning protein tyrosine kinase
  7. 734741Species Human (Homo sapiens) [TaxId:9606] [111201] (3 PDB entries)
  8. 734745Domain d1u4db_: 1u4d B: [107669]
    complexed with cl, dbq

Details for d1u4db_

PDB Entry: 1u4d (more details), 2.1 Å

PDB Description: Structure of the ACK1 Kinase Domain bound to Debromohymenialdisine
PDB Compounds: (B:) Activated CDC42 kinase 1

SCOP Domain Sequences for d1u4db_:

Sequence, based on SEQRES records: (download)

>d1u4db_ d.144.1.7 (B:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
pqdiynvmvqcwahkpedrptfvalrdflleaqp

Sequence, based on observed residues (ATOM records): (download)

>d1u4db_ d.144.1.7 (B:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclamddfirevnamhsld
hrnlirlygvvltppmkmvtelaplgslldrlrkhqllgtlsryavqvaegmgyleskrf
ihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapeslktrtfs
hasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqcw
ahkpedrptfvalrdflleaqp

SCOP Domain Coordinates for d1u4db_:

Click to download the PDB-style file with coordinates for d1u4db_.
(The format of our PDB-style files is described here.)

Timeline for d1u4db_: