Lineage for d1u4ca_ (1u4c A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2066095Family b.69.4.2: Cell cycle arrest protein BUB3 [110289] (2 protein domains)
    possibly related to the WD-repeat family; both sequence similarity between the blades and the WD40 repeat signature are very weak
  6. 2066096Protein Cell cycle arrest protein BUB3 [110290] (1 species)
  7. 2066097Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110291] (2 PDB entries)
    Uniprot P26449
  8. 2066099Domain d1u4ca_: 1u4c A: [107666]

Details for d1u4ca_

PDB Entry: 1u4c (more details), 2.35 Å

PDB Description: Structure of spindle checkpoint protein Bub3
PDB Compounds: (A:) Cell cycle arrest protein BUB3

SCOPe Domain Sequences for d1u4ca_:

Sequence, based on SEQRES records: (download)

>d1u4ca_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
acsdnilclatsddtfktnaaidqtielnassiyiifdye

Sequence, based on observed residues (ATOM records): (download)

>d1u4ca_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
ngtieesglkyqirdvallpkeqegyacssidgrvaveffddsskrfafrchrnlaypvn
siefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdnilclatsddt
fktnaatielnassiyiifdye

SCOPe Domain Coordinates for d1u4ca_:

Click to download the PDB-style file with coordinates for d1u4ca_.
(The format of our PDB-style files is described here.)

Timeline for d1u4ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u4cb_