SCOP 1.69: Domain d1u48a1: 1u48 A:299-468

Lineage for d1u48a1 (1u48 A:299-468)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (31 PDB entries)

8. Domain d1u48a1: 1u48 A:299-468 [107660]
   Other proteins in same PDB: d1u48a2

Details for d1u48a1

PDB Entry: 1u48, 2.1 Å

PDB Description: extension of a cytosine-8-oxoguanine base pair

SCOP Domain Sequences for d1u48a1:

Sequence; same for both SEQRES and ATOM records:

>d1u48a1 c.55.3.5 (A:299-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
maftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqfv
awlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmkq
yeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d1u48a1:

• d1u48a1 is new in SCOP 1.69
  
• d1u48a1 appears in SCOP 1.71
  
• d1u48a1 appears in the current release, SCOPe 2.08