Lineage for d1u47a2 (1u47 A:469-876)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517941Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 517942Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 517943Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 517944Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 517945Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (31 PDB entries)
  8. 517965Domain d1u47a2: 1u47 A:469-876 [107659]
    Other proteins in same PDB: d1u47a1

Details for d1u47a2

PDB Entry: 1u47 (more details), 2 Å

PDB Description: cytosine-8-oxoguanine base pair at the polymerase active site

SCOP Domain Sequences for d1u47a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u47a2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOP Domain Coordinates for d1u47a2:

Click to download the PDB-style file with coordinates for d1u47a2.
(The format of our PDB-style files is described here.)

Timeline for d1u47a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u47a1