SCOPe 2.07: Domain d1u41d_: 1u41 D:

Lineage for d1u41d_ (1u41 D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries)

8. Domain d1u41d_: 1u41 D: [107651]
   mutant

Details for d1u41d_

PDB Entry: 1u41, 2.2 Å

PDB Description: crystal structure of ylgv mutant of dimerisation domain of nf-kb p50 transcription factor

PDB Compounds: (D:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d1u41d_:

Sequence, based on SEQRES records:

>d1u41d_ b.1.18.1 (D:) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
rqfgivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Sequence, based on observed residues (ATOM records):

>d1u41d_ b.1.18.1 (D:) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeegvwegfgdfsptdvhrqf
givfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d1u41d_:

• d1u41d_ first appeared in SCOP 1.69
  
• d1u41d_ appears in SCOPe 2.06
  
• d1u41d_ appears in the current release, SCOPe 2.08