Lineage for d1u41d_ (1u41 D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658572Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 658584Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 658585Species Human (Homo sapiens) [TaxId:9606] [49249] (8 PDB entries)
  8. 658593Domain d1u41d_: 1u41 D: [107651]
    mutant

Details for d1u41d_

PDB Entry: 1u41 (more details), 2.2 Å

PDB Description: crystal structure of ylgv mutant of dimerisation domain of nf-kb p50 transcription factor
PDB Compounds: (D:) Nuclear factor NF-kappa-B p105 subunit

SCOP Domain Sequences for d1u41d_:

Sequence, based on SEQRES records: (download)

>d1u41d_ b.1.18.1 (D:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
rqfgivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Sequence, based on observed residues (ATOM records): (download)

>d1u41d_ b.1.18.1 (D:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeegvwegfgdfsptdvhrqf
givfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOP Domain Coordinates for d1u41d_:

Click to download the PDB-style file with coordinates for d1u41d_.
(The format of our PDB-style files is described here.)

Timeline for d1u41d_: