SCOP 1.69: Domain d1u41b_: 1u41 B:

Lineage for d1u41b_ (1u41 B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (6 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49249] (8 PDB entries)

8. Domain d1u41b_: 1u41 B: [107649]

Details for d1u41b_

PDB Entry: 1u41, 2.2 Å

PDB Description: crystal structure of ylgv mutant of dimerisation domain of nf-kb p50 transcription factor

SCOP Domain Sequences for d1u41b_:

Sequence, based on SEQRES records:

>d1u41b_ b.1.18.1 (B:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens)}
nlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq
fgivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Sequence, based on observed residues (ATOM records):

>d1u41b_ b.1.18.1 (B:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens)}
nlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeegvwegfgdfsptdvhrqfgi
vfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d1u41b_:

• d1u41b_ is new in SCOP 1.69
  
• d1u41b_ appears in SCOP 1.71
  
• d1u41b_ appears in the current release, SCOPe 2.08